PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G010278.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family MYB
Protein Properties Length: 349aa    MW: 39116.1 Da    PI: 5.945
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G010278.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.57.5e-141461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg W++eEd + +++v ++G+  W+++++  g++R++k+c++r +++l
  HL.SW.v1.0.G010278.1 14 RGLWSEEEDARMLEYVSKHGKAKWTSVPKGAGLRRCGKSCRLRSNNHL 61
                          788****************************************99986 PP

2Myb_DNA-binding47.54.1e-1569110346
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           ++T+ E+el+v++++  G++ W+ Ia+ ++ gRt++++k++w++
  HL.SW.v1.0.G010278.1  69 SFTPKEEELIVKLHAAIGSR-WSMIAQQLP-GRTDNDVKNYWNT 110
                           79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-20764IPR009057Homeodomain-like
PROSITE profilePS5129422.942965IPR017930Myb domain
SuperFamilySSF466893.03E-2511108IPR009057Homeodomain-like
SMARTSM007179.2E-91363IPR001005SANT/Myb domain
PfamPF002493.6E-121461IPR001005SANT/Myb domain
CDDcd001675.70E-71761No hitNo description
Gene3DG3DSA:1.10.10.609.6E-2365116IPR009057Homeodomain-like
PROSITE profilePS5129418.17766116IPR017930Myb domain
SMARTSM007174.0E-1366114IPR001005SANT/Myb domain
CDDcd001674.09E-1069112No hitNo description
PfamPF002495.4E-1369110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MVRPSSSDKP NLKRGLWSEE EDARMLEYVS KHGKAKWTSV PKGAGLRRCG KSCRLRSNNH  60
LRPDLNHESF TPKEEELIVK LHAAIGSRWS MIAQQLPGRT DNDVKNYWNT KLRKKLSEMG  120
IDPVTHKPFS QIIADYGNVG GLPKNGMRIG SLNKDLKNAI LMKMEPKGSL PNTTNTRHFM  180
PILPTQATTI MTNIAPKTEP TLDIFLSNDK NILSNDKSSL DLLSQLQSIK LVTEVPNYKL  240
NCESSLPSFY PEATFSPSSS SSSSNTQEMS SIAFNWNDFL LEDVFLPNEA QEHETSMAEF  300
ISSSQNLSQN QSEGSNDMDN SSFVEALLAR ENEMLLDEFP EFLAESFY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-271011623128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008239672.11e-125PREDICTED: transcription factor MYB51
RefseqXP_008239671.11e-125PREDICTED: transcription factor MYB51
TrEMBLM5WT281e-124M5WT28_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s07900.11e-112(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.17e-63MYB family protein